PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 324aa    MW: 36220.8 Da    PI: 7.7781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602016.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I+++ g+ R++k+c++rw +yl
   XP_009602016.1 14 RGQWTPEEDHKLSSYIAQHGTRNWRLIPKHAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding46.11.1e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++ E++ +v ++  lG++ W+ Ia+ ++ gRt++++k++w++
   XP_009602016.1  68 GQFSEAEEQTIVTLHSVLGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.91965IPR017930Myb domain
SuperFamilySSF466891.91E-2911108IPR009057Homeodomain-like
SMARTSM007173.6E-131363IPR001005SANT/Myb domain
PfamPF002497.3E-181461IPR001005SANT/Myb domain
CDDcd001671.89E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.93866116IPR017930Myb domain
SMARTSM007173.7E-1366114IPR001005SANT/Myb domain
PfamPF002493.8E-1368110IPR001005SANT/Myb domain
CDDcd001678.29E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDHKLSSYIA QHGTRNWRLI PKHAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SEAEEQTIVT LHSVLGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLISEIANTL SPPQVPHLAE AALGCFKDEM LHLLTKKRIG FQFQFQQFGM  180
ASTATTAPNN GPSTSVKHED NKDETIEKIK YGLSRAIKEP DMLNPIKNWD TTNFPVSENG  240
GFNYNFASLL NEGEGSPWNQ SLCSGSTCTA GGELQQHKRI SNENCGENSE GGKEIVTRNG  300
STTVFNSDCV LWDISSDDLM NPMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-30141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4157550.0HQ415755.1 Lycium barbarum putative Myb103 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602016.10.0PREDICTED: transcription factor MYB3
SwissprotQ7XQN11e-115MYB80_ORYSJ; Transcription factor MYB80
TrEMBLG0XSW40.0G0XSW4_LYCBA; Putative Myb103 transcription factor
STRINGPGSC0003DMT4000224020.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-114myb domain protein 103